Recombinant Mouse NMES1 Protein (Tagged)
Beta LifeScience
SKU/CAT #: BLA-9982P
Recombinant Mouse NMES1 Protein (Tagged)
Beta LifeScience
SKU/CAT #: BLA-9982P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Mouse |
Accession | Q810Q5 |
Synonym | C15orf48 FLJ22645 FOAP-11 MGC32925 NMES1 NMES1_HUMAN Normal mucosa of esophagus-specific gene 1 protein Protein FOAP-11 |
Description | Recombinant Mouse NMES1 Protein (Tagged) was expressed in Mammalian. It is a Full length protein |
Source | Mammalian |
AA Sequence | MGVFQILMKNKELIPLAFFISVAATGATSFALYALKKTDVVIDRKRNPEP WEMVDPTQPQKLITINQQWKPVEELQKVRRATR |
Molecular Weight | 10 kDa |
Purity | >90% by SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Target Details
Subcellular Location | Nucleus. |
Protein Families | Complex I NDUFA4 subunit family |
Database References | |
Tissue Specificity | Strongly expressed in vertebrae, brain, intestine and stomach. |