Recombinant Mouse OCM Protein (Tagged)
Beta LifeScience
SKU/CAT #: BLA-9988P
Recombinant Mouse OCM Protein (Tagged)
Beta LifeScience
SKU/CAT #: BLA-9988P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Mouse |
Accession | P51879 |
Synonym | Ocm OCMN OM onco ONCO_HUMAN Oncomodulin-1 Parvalbumin beta |
Description | Recombinant Mouse OCM Protein (Tagged) was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | SITDILSADDIAAALQECQDPDTFEPQKFFQTSGLSKMSASQLKDIFQFI DNDQSGYLDEDELKYFLQRFQSDARELTESETKSLMDAADNDGDGKIGAD EFQEMVHS |
Molecular Weight | 28 kDa including tags |
Purity | >90% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Target Details
Target Function | Has some calmodulin-like activity with respect to enzyme activation and growth regulation. Binds two calcium ions. |
Protein Families | Parvalbumin family |
Database References | |
Tissue Specificity | Found in tumor tissues and not detected in normal tissues. |
Gene Functions References
- These data suggest that Ocm may have distinct functional roles in cochlear and vestibular hair cells. PMID: 20653034
- absence of parvalbumin has no major effect on the GABA-synthesizing system in diencephalon presynaptic terminals; however, a likely homeostatic mechanism is induced resulting in the upregulation of oncomodulin in selected axons and neuronal perikarya PMID: 19874871