Recombinant Mouse Pancreatic Lipase/PTL Protein (His tag)

Name: Recombinant Mouse Pancreatic Lipase/PTL Protein (His tag)
Brand: Beta LifeScience
SKU: BLA-9998P
Availability: InStock

Collections: Other recombinant proteins, Recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Host Species	Mouse
Accession	Q6P8U6
Synonym	lipase, pancreatic LIPP_HUMAN Pancreatic lipase Pancreatic triacylglycerol lipase PL PNLIP PNLIPD PTL Triacylglycerol acylhydrolase
Description	Recombinant Mouse Pancreatic Lipase/PTL Protein (His tag) was expressed in E.coli. It is a Full length protein
Source	E.coli
AA Sequence	REVCFDKLGCFSDDAPWSGTLDRPLKALPWSPAQINTRFLLYTNENPDNY QLITSDASNIRNSNFRTNRKTRIIIHGFIDKGEENWLSDMCKNMFRVESV NCICVDWKGGSRTTYTQATQNVRVVGAEVALLVNVLQSDLGYSLNNVHLI GHSLGSHIAGEAGKRTFGAIGRITGLDPAEPYFQGTPEEVRLDPTDAQFV DAIHTDAGPIIPNLGFGMSQTVGHLDFFPNGGIEMPGCQKNILSQIVDID GIWEGTRNFAACNHLRSYKFYTDSIVNPTGFAGFSCSSYSLFTANKCFPC GSGGCPQMGHYADRYPGKTSRLYQTFYLNTGDKSNFARWRYQVTVTLSGQ KVTGHILVSLFGNGGNSKQYEVFKGSLQPGTSHVNEFDSDVDVGDLQKVK FIWYNNVINPTLPKVGASRITVERNDGRVFNFCSQETVREDVLLTLSPC
Molecular Weight	66 kDa including tags
Purity	>90% SDS-PAGE.
Endotoxin	< 1.0 EU per μg of the protein as determined by the LAL method
Formulation	Liquid Solution
Stability	The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution	See related COA
Unit Definition	For Research Use Only
Storage Buffer	Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

Target Details

Target Function	Plays an important role in fat metabolism. It preferentially splits the esters of long-chain fatty acids at positions 1 and 3, producing mainly 2-monoacylglycerol and free fatty acids, and shows considerably higher activity against insoluble emulsified substrates than against soluble ones.
Subcellular Location	Secreted.
Protein Families	AB hydrolase superfamily, Lipase family
Database References	KEGG: mmu:69060 STRING: 10090.ENSMUSP00000056377 UniGene: Mm.20407
Tissue Specificity	Pancreas.

Gene Functions References

the ability to degrade unfolded protein decreases in the aging pancreas, and this leads to reduction of pancreatic lipase activity and a decrease in lipid absorption PMID: 25033985
pancreatic triglyceride lipase has a critical role in dietary cholesterol absorption and a minimal role in dietary fat absorption in mice PMID: 12915407
PTL and CEL serve complementary functions, working together to mediate the absorption of a major portion of dietary fat and fat-soluble vitamin esters PMID: 17604277

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.