Recombinant Rat Synapsin-1 (SYN1) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-06618P

Greater than 85% as determined by SDS-PAGE.
Recombinant Rat Synapsin-1 (SYN1) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-06618P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Rat Synapsin-1 (SYN1) Protein (His) is produced by our Yeast expression system. This is a protein fragment. |
Purity | Greater than 85% as determined by SDS-PAGE. |
Uniprotkb | P09951 |
Target Symbol | SYN1 |
Synonyms | (Synapsin I) |
Species | Rattus norvegicus (Rat) |
Expression System | Yeast |
Tag | C-6His |
Target Protein Sequence | ARVLLVIDEPHTDWAKYFKGKKIHGEIDIKVEQAEFSDLNLVAHANGGFSVDMEVLRNGVKVVRSLKPDFVLIRQHAFSMARNGDYRSLVIGLQYAGIPSVNSLHSVYNFCDKPWVFAQMVRLHKKLGTEEFPLIDQTFYPNHKEMLSSTTYPVVVKMGHAHSGMGKVKVDNQHDFQDIASVVALTKTYATAEPFIDAKYDVRVQKIGQNYKAYMRTSVSGNWKTNTGSAMLEQIAMSDRYKLWVDTCSEIFGGLDICAVEALHGKDGRDHIIEVVGSSMPLIGDHQDEDKQLIVELVVNKMTQALPR |
Expression Range | 113-420aa |
Protein Length | Partial |
Mol. Weight | 35.6 kDa |
Research Area | Others |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Neuronal phosphoprotein that coats synaptic vesicles, binds to the cytoskeleton, and is believed to function in the regulation of neurotransmitter release. |
Subcellular Location | Cell junction, synapse. Golgi apparatus. |
Protein Families | Synapsin family |
Database References |
Gene Functions References
- The synapsin 1 in the insular cortex as a part of pathophysiological process that determines predisposition of Krushinsky-Molodkina rats to audiogenic seizures. PMID: 26923581
- SUMOylation of synapsin Ia (SynIa) at K687 is necessary for SynIa function. Replacement of endogenous SynIa with a non-SUMOylatable mutant decreases the size of the releasable vesicle pool and impairs stimulated SV exocytosis. PMID: 26173895
- Results suggest a mechanism of A2aR modulation of neurotransmitter release in cultured cells from medulla oblongata and suggest that protein kinase A mediates this modulation of neurotransmitter release via synapsin I phosphorylation PMID: 24912137
- rSynI(1.0)-minCMV drives robust and neuron-specific transgene expression throughout the CNS and is therefore useful for viral vector-mediated neuron-specific gene delivery and generation of neuron-specific transgenic animals. PMID: 24361760
- This study demonistrated that Increased activation of synapsin 1 in the amygdala of maternal separation rats. PMID: 24279756
- O-GlcNAcylation of Thr-87 interferes with folding of the ALPS motif, providing a means for regulating the association of synapsin I with SVs as a mechanism contributing to synapsin I localization and RPSV generation. PMID: 24280219
- The mean brightness of Syn1 per unit area of the dendritic tree of neurons changes over the estrous cycle, being approximately 35% lower at diestrus than at the remaining phases of the estrous cycle. PMID: 21948316
- A hybrid peptide consisting of synapsin carboxyl domain fused with E coli enterotoxin B subunit up-regulates expression of anti-inflammatory cytokines and diminishes myelin basic protein-specific T-helper cell responses in lymph nodes. PMID: 22138356
- Syn I phosphorylation at site 1 regulates synapse formation. PMID: 22045728
- Data provide a complete molecular pathway (GR/Egr-1/MAPK/Syn-Ia/Ib) through which stress and glucocorticoids enhance the memory of stress-related events and highlight the function of synapsin-Ia/Ib as molecular effector of the behavioral effects of stress PMID: 20368707
- Data show that Src-mediated tyrosine phosphorylation of synapsin I increases its binding to synaptic vesicles and actin, and increases the formation of synapsin dimers, which are both potentially involved in vesicle clustering. PMID: 20530578
- Data suggest that integrin-linked kinase exerts pleiotropic actions by regulating pre- and postsynaptic neural plasticities in response to repeated cocaine exposure through PSD-95 and synapsin I expression and GluR1 Ser845 phosphorylation. PMID: 19629758
- Either C-terminal domain E or a peptide derived from domain C was necessary and sufficient to inhibit both dimerization and vesicle clustering, indicating the participation of both domains in these activities of synapsin I. PMID: 19922412
- Seven days after fluid-percussion brain injury, synapsin I mRNA levels increase ipsilaterally and decrease contralaterally in the occipital cortex. PMID: 12184851
- These results raise the possibility that Ser(603) on synapsin I is alternatively phosphorylated by p21-activated kinases, not only by CaMKII, in neuronal cells in response to some stimulants. PMID: 12237306
- BEMAD methodology was validated by mapping three previously identified O-GlcNAc sites, as well as three novel sites, on Syn I. PMID: 12438562
- multiple signaling pathways serve to allow synapsin's control of vesicle mobilization over different stimulus frequencies. PMID: 12691665
- Time-dependent translocational changes of Synapsin I were investigated in regenerating axonal sprouts. PMID: 14612614
- Calorimetric measurements of ATP binding to wild-type and mutant recombinant Synapsin I-ABC demonstrate that the multifunctional loop and a cross-tetramer contact are important for ATP binding PMID: 14688264
- During the first postnatal week,synpsin 1 immunoreactive strongly concentrated in the Purkinje cell layer.By P14, synapsin 1 localized to many small puncta in the ML and to large clusters at mossy fiber rosettes in the glomerular layer. PMID: 15246689
- glucose-dependent actions of ERK1/2 in beta-cells exerted on cytoplasmic proteins, includes synapsin I and participates in the overall glucose-induced insulin secretion. PMID: 15498890
- In conclusion, this is the first evidence to show that PLD1 acts as an important regulator of neurite outgrowth in neural stem cell by promoting neuronal differentiation via increase of synapsin I expression. PMID: 15752728
- findings show that synapsin I plays a central role in regulating the organization and dynamics of synaptic vesicles in growth cones and that this activity is modulated by cAMP-dependent phosphorylation of the protein PMID: 16093379
- Neither haloperidol nor the dopamine-D1 receptor antagonist affected synapsin I protein expression. PMID: 16413126
- These results suggest, therefore, that Ca2+ entrance mediated by P2X7 receptor induces glutamate release and in parallel synapsin-I phosphorylation. PMID: 18242779
- Synapsin1a modulation by piccolo regulates synaptic vesicle exocytosis PMID: 18519737
- Data suggest that diabetes has a profound impact on synapsin I and other presynaptic protein expression in the retina, and may provide a mechanism for the well-established defects in vision and the electrophysiological response of the retina in diabetes. PMID: 18662330
- Synapsin I is embedded in open chromatin in R28 retinal precursor cells. PMID: 18692536
- Data show that long-term amygdala kindling increases synapsin I immunoreactivity bilaterally in most hippocampal subfields, but not in the caudate nucleus, sensorimotor cortices, or piriform cortex in rats. PMID: 18703092
- pentachlorophenol exposure during development causes thyroid function vulnerability, testicular hypertrophy in adults, and aberrations of brain gene expression of syn1 PMID: 19082768
- mW/cm(2) (SAR 14.1 W/kg) microwave radiation can result in the perturbation of the synaptic vesicles associated proteins: synapsin I, synaptophysin, VAMP-2, and syntaxin PMID: 19603498