Recombinant Rat Urokinase Plasminogen Activator Surface Receptor (PLAUR) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-09710P

Greater than 90% as determined by SDS-PAGE.
Recombinant Rat Urokinase Plasminogen Activator Surface Receptor (PLAUR) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-09710P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Rat Urokinase Plasminogen Activator Surface Receptor (PLAUR) Protein (His) is produced by our Yeast expression system. This is a full length protein. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | P49616 |
Target Symbol | PLAUR |
Synonyms | PlaurUrokinase plasminogen activator surface receptor; U-PAR; uPAR; CD antigen CD87 |
Species | Rattus norvegicus (Rat) |
Expression System | Yeast |
Tag | N-6His |
Target Protein Sequence | LRCIQCESNQDCLVEECALGQDLCRTTVLREWEDAEELEVVTRGCAHKEKTNRTMSYRMGSVIVSLTETVCATNLCNRPRPGARGRPFPRGRYLECASCTSLDQSCERGREQSLQCRYPTEHCIEVVTLQSTERSVKDEPYTKGCGSLPGCPGTAGFHSNQTFHFLKCCNFTQCNGGPVLDLQSLPPNGFQCYSCEGNSTFGCSYEETSLIDCRGPMNQCLEATGLDVLGNRSYTVRGCATASWCQGSHVADSFQTHVNLSISCCNGSGCNRPTG |
Expression Range | 25-299aa |
Protein Length | Full Length of Mature Protein |
Mol. Weight | 32.8kDa |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Acts as a receptor for urokinase plasminogen activator. Plays a role in localizing and promoting plasmin formation. Mediates the proteolysis-independent signal transduction activation effects of U-PA. |
Subcellular Location | [Isoform 1]: Cell membrane; Lipid-anchor, GPI-anchor.; [Isoform 2]: Secreted. |
Database References |
Gene Functions References
- Increased postmortem PLAUR expression could serve as a biomarker to aid diagnosis of early myocardial infarction. PMID: 24935436
- Rapamycin could promote podocyte migration through the up-regulation of uPAR leading to proteinuria. PMID: 24815166
- uPA, uPAR, MMP-2 and MMP-9 play an important role in GBM growth. Blockade of uPA and interruption of the proteolytic cascade could become a useful tool in the therapy of GBM PMID: 22773570
- uPAR associates with activating enhancer-binding protein 2alpha (AP2a) and mediates beta-catenin gene transcription. PMID: 22511755
- study examines the expression and function of uPAR in developing rat ventral prostates PMID: 11798065
- Expression pattern of the urokinase-plasminogen activator system in rat DS-sarcoma: role of oxygenation status and tumour size PMID: 11953898
- Decreased expression of intercellular adhesion molecule-1 (ICAM-1) is associated with tumor cell spreading in vivo. PMID: 12198772
- demonstrated focused activation of proteolytic enzymatic activity in several cell types and showed that the uPA/uPAR system is an important contributor to focal pericellular proteolysis PMID: 15042374
- Altered expression of uPAR in diabetic nephropathy was associated with mesangial expansion. PMID: 15322501
- Domain 2 of the urokinase receptor plays a pivotal role in the regulation of uPAR-integrin alphavbeta3 interactions PMID: 15863511
- The members of caspases, MEK1/2, PKC, and NF-kappaB are involved in TRAIL-induced expression of uPA, IL-8, MMP-7 and MMP-9. PMID: 18397859
- In animals undergoing SE, uPAR expression increased dramatically, peaking at 1 and 4 days after SE. Increased uPAR expression during post-injury phase supports its contribution to tissue remodeling in the brain. PMID: 19527776