Recombinant Rat Vasopressin V1A Receptor (AVPR1A) Protein (GST)

Name: Recombinant Rat Vasopressin V1A Receptor (AVPR1A) Protein (GST)
Brand: Beta LifeScience
SKU: BLC-08265P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: Other recombinant proteins, Recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Rat Vasopressin V1A Receptor (AVPR1A) Protein (GST) is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P30560
Target Symbol	AVPR1A
Synonyms	Avpr1aVasopressin V1a receptor; V1aR; AVPR V1a; Antidiuretic hormone receptor 1a; Vascular/hepatic-type arginine vasopressin receptor
Species	Rattus norvegicus (Rat)
Expression System	E.coli
Tag	N-GST
Target Protein Sequence	SQDRSVGNSSPWWPLTTEGSNGSQEAARLGEGDSPLGDVRNEELAK
Expression Range	7-52aa
Protein Length	Partial
Mol. Weight	31.9kDa
Research Area	Others
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Receptor for arginine vasopressin. The activity of this receptor is mediated by G proteins which activate a phosphatidyl-inositol-calcium second messenger system. Involved in social memory formation.
Subcellular Location	Cell membrane; Multi-pass membrane protein. Cytoplasmic vesicle membrane; Multi-pass membrane protein. Note=Located in cytoplasmic vesicles dispersed throughout the cell cytoplasm and to the plasma membrane.
Protein Families	G-protein coupled receptor 1 family, Vasopressin/oxytocin receptor subfamily
Database References	KEGG: rno:25107 STRING: 10116.ENSRNOP00000005829 UniGene: Rn.32282
Tissue Specificity	Localized within gonadotropes of the anterior pituitary of the brain. Broadly distributed throughout the cerebral cortex.

Gene Functions References

data support a role for altered signalling via central Avpr1a in PreNatal Stress-induced sex-dependent changes in social memory. PMID: 26613552
Increased expression of V1aR in hypothalamic paraventricular nucleus influences autonomic cardiovascular regulation and demarcates vulnerability to stress. PMID: 27810519
Vasopression V1a receptor binding density was higher in juveniles than in adults in regions associated with reward and socio-spatial memory and higher in adults than in juveniles in key regions of the social decision-making network and in cortical regions. PMID: 27389643
Vasopressin V1A receptors mediate the beneficial effects of hypercapnia on microcirculatory oxygenation during sepsis. PMID: 26969105
Stimulation of V1a receptor induces the downregulation of GLUT9, reabsorption urate transporter, together with the upregulation of ABCG2 and NPT1, secretion urate transporters, all changes of which clearly lead to increase in renal uric acid clearance. PMID: 26935049
This study demonstrated that Vasopressin V1a receptor within the PVN of lactating rats mediate maternal care and anxiety-related behaviour. PMID: 26909846
The combination of V1aR and V2R antagonists prevented cardiac/renal damage in rat model of hypertensive heart failure. PMID: 26248278
AVP plays an important role in modulating the salt-induced sympathoexcitation and high blood pressure, via V1a receptors, within the paraventricular nucleus of male rats. PMID: 26354848
Myocardial infarction and chronic stress cause significant but differential changes in the regulation of V1a receptors expression in the brain and the kidney. PMID: 25169016
Oxytocin inhibits ASICs through V1A receptors in sensory neurons modulating nociception and pain. PMID: 24641084
Mice lacking V1a receptors have less secondary brain damage following experimental traumatic brain injury. PMID: 23441636
These data suggest that in SHR rats, activation of plasma AVP and the renal V(1A) receptor occurs during developing hypertension, with downregulation when hypertension is established. PMID: 23246465
vasopressin V(1a) receptors exert a modulatory influence on the neural response to a predator odor PMID: 23219972
High extracellular glucose downregulates vasopressin V1A receptors on rat mesangial cells and modulates their signal transduction properties via protein kinase (PK)C activation. PMID: 22352691
The data showed that activation of arginine vasopressin V1a receptors by arginine vasopressin in the lateral septum is important for social recognition in both sexes, and that the roles of septal V1a receptors in social recognition change during aging. PMID: 22033278
V1a vasopressin receptor mRNA and protein expressions are significantly down-regulated in cerebellum from post-infarct heart failure; they are not affected by mild chronic stressing. PMID: 21652017
The results of this study suggested that, in humans, vasopressin, acting on V1AR, produces inhibition of capsaicin-induced pain by activating endogenous (stress induced) analgesic systems. PMID: 22019732
V(A)R plays a physiological role in preventing urine leakage. PMID: 21228111
Aldosterone requires vasopressin V1a receptors on intercalated cells to mediate acid-base homeostasis. PMID: 21415155
Spinal V1a receptors are not required for elevations of mean arterial pressure under conditions of acute or chronic osmotic stress in conscious rats. PMID: 21123759
V(1a) receptor plays an important role in argipressin-mediated regulation of vascular reactivity and calcium sensitivity following hemorrhagic shock. PMID: 19577256
central V(1)Rs are involved in potentiation of cardiovascular responses to acute stress in chronically stressed rats, infarcted rats, and chronically stressed infarcted rats PMID: 20042688
mRNA expression for V(1a) and V(1b) AVP receptors in isolated rat adrenal chromaffin cells treated with vasopressin PMID: 12047911
Activation of V1A vasopressin receptor induces a rise of both cytoplasmic and nuclear calcium in cultured cortical astrocytes. PMID: 12088846
compared expression of V1a, V1b and V2 vasopressin receptor mRNA in the renal cortex, renal medulla and the heart of hypertensive renin transgenic TGR(mRen2)27 rats (TGR) and of their parent normotensive Sprague Dawley (SD) strain PMID: 12369733
the presence of vasopressin V1a receptors on gonadotropes supports the controversial hypothesis of a local direct action of the neuropeptide on this cell type PMID: 12399435
Increased amounts of renal cortex V1A receptors in spontaneously hypertensive rats play an important role in the pathophysiology of hypertension. PMID: 12566855
Vasopressin binding sites of the V1a receptor type are present in all laminae of the central gray at all segmental levels, whereas oxytocin binding sites are found only in the superficial layers of the dorsal horn. PMID: 12752783
CsA-induced superoxide generation is causally involved in vasopressin type 1A receptor expression and low physiological concentrations of radicals are able to directly affect cellular signaling to increase Avpr1a expression in aortic smooth muscle cells. PMID: 12923165
Ca(2+) increase induced by vasopressin was correlated with the number of V1a receptors. PMID: 12971956
No significant changes either in V(1a) receptor mRNA or protein levels were observed in pregnancy suggesting variations in the hypothalamic V(1a) receptor expression levels alone cannot account for the endogenous antipyresis observed at term PMID: 14552875
that the V(1a) receptor is increased at protein and mRNA level during development of hypertension in SHR rats but is normalized when hypertension is established. PMID: 15075196
during specific physiological states, pituicyte V(1a) receptor activation modulates the release of neurohypophysial hormones. PMID: 15089968
V(1a)-mediated arginine-vasopressin actions may influence LHRH release via cells in the immediate vicinity of LHRH neurones and/or via oestrogen-regulated cells in the anteroventral periventricular nucleus. PMID: 15189327
A vasopressinergic pathway projects to the lateral area of the ventrolateral medulla (VLM) and modulates cardiopulmonary functions via AVP V1A receptors on neurons within the lateral VLM. PMID: 15239592
AVP acts through V1a receptors and is involved in endogenous central histamine-induced reversal of critical haemorrhagic hypotension in rats PMID: 15241560
Rats with experimental renovascular hypertension manifest significantly higher expression of V1aR mRNA in the preoptic brain region in comparison to sham operated rats. PMID: 15613739
V(1a) vasopressin receptor binding in several forebrain areas seems to be affected by brief periods of social interactions, and, in the lateral septum, it also appears to be related to dominance status. PMID: 16154572
altered reactivity to V1A of V1 receptor in the superior mesenteric and/or hindquarter vascular regions of SHR PMID: 16398053
The results provide evidence for enhanced engagement of the brain V1 VP receptors in regulation of resting MABP and in generation of exaggerated cardiovascular responses to air jet stress during the post-infarct state. PMID: 16423716
Our findings demonstrate the importance of vasopressin acting on spinal V(1a) receptors for mediating sympathoexcitatory response to acute salt loading. PMID: 16873404
Expression of the V(2)R is downregulated via V(1a)R pathway in LLC-PK(1)/rV(1a)R cells, and expression of V(2)R is downregulated by PMA-induced PKC pathway and upregulated by cAMP-PKA pathway. PMID: 17213462
renal collecting duct cells Arginine-vasopressin selectively activates, via a complex of V1 and V2 receptor-mediated actions PMID: 17762181
Modulation by vasopressin of the lateral septal circuitry may be part of the neuronal mechanism by which the peptide, acting via V(1A) receptors, promotes social recognition. PMID: 17970727
Results show that both Avpr1a and b are involved in anxiety-related responses, and suggest that different fear responses are under the control of specific AVP receptor systems within discrete parts of the hippocampus. PMID: 18508119
Oxytocin-induced contractions within rat and rabbit ejaculatory tissues are mediated by vasopressin V1A receptors and not oxytocin receptors. PMID: 18552879
The counteractivity of V2R and V1aR could be required to maintain minimum urine volume in the dehydrated state PMID: 18701631
findings support the concept that dendritic release of VP from magnocellular neurons within the PVN mediates, at least in part, the pressor response to ET(A) receptor activation at the SFO. PMID: 19258664
Low pH stimulates vasopressin V2 receptor promoter activity and enhances downregulation induced by V1a receptor stimulation. PMID: 19587140
V1/V2 Vasopressin receptor antagonism potentiates the renoprotection of renin-angiotensin system inhibition in rats with renal mass reduction. PMID: 19625993

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.