Recombinant Receptor-Type Tyrosine-Protein Phosphatase Zeta (PTPRZ1) Protein (His)

Name: Recombinant Receptor-Type Tyrosine-Protein Phosphatase Zeta (PTPRZ1) Protein (His)
Brand: Beta LifeScience
SKU: BLC-04681P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) PTPRZ1.

Collections: Other recombinant proteins, Recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Receptor-Type Tyrosine-Protein Phosphatase Zeta (PTPRZ1) Protein (His) is produced by our Yeast expression system. This is a protein fragment.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P23471
Target Symbol	PTPRZ1
Synonyms	3F8 chondroitin sulfate proteoglycan; 3H1 keratan sulfate proteoglycan; HPTPZ; HPTPzeta; Phosphacan; Protein tyrosine phosphatase receptor type Z polypeptide 2; Protein tyrosine phosphatase, receptor type, Z polypeptide 1; Protein tyrosine phosphatase, receptor type, zeta polypeptide 1; Protein-tyrosine phosphatase receptor type Z polypeptide 1; Protein-tyrosine phosphatase receptor type Z polypeptide 2; PTP-ZETA; PTP18; PTPRZ; PTPRZ_HUMAN; Ptprz1; PTPZ; R PTP zeta 2; R-PTP-zeta; R-PTP-zeta-2; Receptor type tyrosine phosphatase beta/zeta; Receptor-type tyrosine-protein phosphatase zeta; RPTP-BETA; RPTPB; RPTPbeta
Species	Homo sapiens (Human)
Expression System	Yeast
Tag	N-6His
Target Protein Sequence	IGWSYTGALNQKNWGKKYPTCNSPKQSPINIDEDLTQVNVNLKKLKFQGWDKTSLENTFIHNTGKTVEINLTNDYRVSGGVSEMVFKASKITFHWGKCNMSSDGSEHSLEGQKFPLEMQIYCFDADRFSSFEEAVKGKGKLRALSILFEVGTEENLDFKAIIDGVESVSRFGKQAALDPFILLNLLPNSTDKYYIYNGSLTSPPCTDTVDWIVFKDTVSISESQLAVFCEVLTMQQSGYVMLMDYLQNNFREQQYKFSRQVFSSY
Expression Range	36-300aa
Protein Length	Partial
Mol. Weight	32.1 kDa
Research Area	Neuroscience
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Protein tyrosine phosphatase that negatively regulates oligodendrocyte precursor proliferation in the embryonic spinal cord. Required for normal differentiation of the precursor cells into mature, fully myelinating oligodendrocytes. May play a role in protecting oligondendrocytes against apoptosis. May play a role in the establishment of contextual memory, probably via the dephosphorylation of proteins that are part of important signaling cascades.
Subcellular Location	[Isoform 1]: Cell membrane; Single-pass type I membrane protein. Secreted.; [Isoform 2]: Secreted.
Protein Families	Protein-tyrosine phosphatase family, Receptor class 5 subfamily
Database References	HGNC: 9685 OMIM: 176891 KEGG: hsa:5803 STRING: 9606.ENSP00000377047 UniGene: Hs.489824
Tissue Specificity	Specifically expressed in the central nervous system, where it is localized in the Purkinje cell layer of the cerebellum, the dentate gyrus, and the subependymal layer of the anterior horn of the lateral ventricle. Developmentally regulated in the brain.

Gene Functions References

Authors characterized exosomes from GBM cells harbouring and not harbouring PTPRZ1-MET fusion (ZM fusion). PMID: 28504721
PTPRZ1 is affected in a contiguous gene deletion syndrome PMID: 23570448
Confirm contribution of PTPRZ1, and especially PTPRQ, in CRC carcinogenesis and demonstrated that PTPRQ expression is correlated with KRAS mutation. PMID: 26851024
Data indicate that enhanced MET oncoprotein RNA expression by fusion with receptor-type tyrosine-protein phosphatase zeta (PTPRZ1). PMID: 25935522
Data indicate that the fusion arose from translocation events involving introns 3 or 8 of protein tyrosine phosphatase, receptor-type, Z polypeptide 1 (PTPRZ1) and intron 1 of hepatocyte growth factor receptor MET. PMID: 25135958
Distinct domains of PTPRZ-B are differentially required for migration and proliferation of glioma cells, respectively. PMID: 25238264
Protein tyrosine phosphatase zeta enhances proliferation by increasing beta-catenin nuclear expression in VHL-inactive human renal cell carcinoma cells. PMID: 23588815
Data suggest that CSF-1R-independent actions of IL-34 via receptor-type protein-tyrosine phosphatase zeta (PTP-zeta) might be considered in evaluating IL-34 roles in development and disease. PMID: 23744080
PTPRZ1 was highly expressed in human neuroendocrine tumor tissues and PTPRZ1 is an oncogenic tyrosine phosphatase in small-cell lung carcinoma. PMID: 23170925
Receptor-type Protein tyrosine phosphatase beta regulates met phosphorylation and function in head and neck squamous cell carcinoma. PMID: 23226095
Studies indicate that RPTPzeta is an RPTP for which a link between ligand-dependent dimerization and inhibition of the intracellular tyrosine phosphatase activity has been clearly established. PMID: 22682003
Enhanced RPTPbeta/zeta signaling can contribute to schizophrenia phenotypes and support both construct and face validity for PTPRZ1-transgenic mice as a model for multiple schizophrenia phenotypes. PMID: 22832403
Loss of RPTPZ promotes prostate cancer metastasi. PMID: 23060448
The results of this study suggested that pleiotrophin inhibition of PTPRZ1 contributes to the homeostatic self-renewal of OPCs and that this process is mediated by the tonic activation of beta-catenin/TCF-dependent transcription. PMID: 23100427
report the cocrystal structure of the carbonic anhydrase-like domain of PTPRZ bound to tandem Ig repeats of CNTN1 and binding assays to show that PTPRZ binds specifically to CNTN1 expressed at the surface of oligodendrocyte precursor cells PMID: 21969550
molecular basis for the substrate recognition of Ptprz. PMID: 21890632
RPTP-beta is a key regulator of Met function. PMID: 21454675
preferential activation of PTPRZ1 by HIF-2 results at least in part from cooperative binding of HIF-2 and ELK1 to nearby sites on the PTPRZ1 promoter region PMID: 20224786
PTPRZ1 has a role in oligodendrocyte survival and in recovery from demyelinating disease PMID: 12355066
RPTPzeta has a novel role in regulating glioblastoma cell motility PMID: 14555979
In AZ-521 cells, which mainly express RPTPbeta, VacA, after binding to RPTPbeta in non-lipid raft microdomains on the cell surface, is localized with RPTPbeta in lipid rafts in a temperature- and VacA concentration-dependent process. PMID: 17030583
Midkine, pleiotrophin (PTN), and their receptors syndecan-3 and receptor protein tyrosine phosphatase beta/zeta, were highly expressed in the striatum during developmen PMID: 17368428
the PTN/RPTPbeta/zeta signaling pathway may be constitutively activated and potentially function to constitutively activate ALK in human breast cancer PMID: 17706593
the effect of the shorter basic peptide P(122-131) on DU145 cells, which express HARP and its receptor RPTPB, suggested interference, under anchorage-independent conditions, of P(122-131) with a HARP autocrine loop in an RPTPB -dependent fashion. PMID: 17727841
Pleiotrophin receptor (PTPRZ1) is expressed in embryonic stem cells and mediates important signals for survival, proliferation, and maintenance of pluripotency state. PMID: 17823238
results from the immunohistochemical analyses of rPTPbeta/zeta expression should prompt further evaluation of this protein as a novel oligodendroglioma marker. PMID: 18003890
PTPRZ1 is unlikely to be related to the development of schizophrenia in the Japanese population PMID: 18186075
the cleavage sites in the extracellular juxtamembrane region of Ptprz by tumor necrosis factor-alpha converting enzyme and matrix metalloproteinase 9. PMID: 18713734
GnT-Vb-mediated glycosylation of RPTPbeta promotes galectin-1 binding and RPTPbeta levels of retention on the cell surface. PMID: 18838383
these data suggest that alpha(v)beta(3) is a key molecule that determines the stimulatory or inhibitory effect of pleiotrophin on cell migration. PMID: 19141530
phosphacan was present in the evolving astroglial scar after human traumatic spinal cord injury, and, therefore, might play an important role in the blockade of successful CNS regeneration. PMID: 19604403

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.