Recombinant Saccharomyces Cerevisiae Gtp-Binding Protein Ypt1 (YPT1) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-08972P

Greater than 90% as determined by SDS-PAGE.
Recombinant Saccharomyces Cerevisiae Gtp-Binding Protein Ypt1 (YPT1) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-08972P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Saccharomyces Cerevisiae Gtp-Binding Protein Ypt1 (YPT1) Protein (His-SUMO) is produced by our E.coli expression system. This is a full length protein. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | P01123 |
Target Symbol | YPT1 |
Synonyms | YPT1; YP2; YFL038C; GTP-binding protein YPT1; Protein YP2; Rab GTPase YPT1; Transport GTPase YPT1 |
Species | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) |
Expression System | E.coli |
Tag | N-6His-SUMO |
Target Protein Sequence | MNSEYDYLFKLLLIGNSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVELDGKTVKLQIWDTAGQERFRTITSSYYRGSHGIIIVYDVTDQESFNGVKMWLQEIDRYATSTVLKLLVGNKCDLKDKRVVEYDVAKEFADANKMPFLETSALDSTNVEDAFLTMARQIKESMSQQNLNETTQKKEDKGNVNLKGQSLTNTGGGCC |
Expression Range | 1-206aa |
Protein Length | Full Length |
Mol. Weight | 39.2kDa |
Research Area | Others |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | The small GTPases Rab are key regulators of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes. Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to recruit to membranes different set of downstream effectors directly responsible for vesicle formation, movement, tethering and fusion. YPT1 regulates the trafficking of secretory vesicles from the endoplasmic reticulum (ER) to the Golgi. Vesicular transport depends on shuttling of YPT1 between membrane and cytosol by GDI1, probably by recycling it to its membrane of origin after a vesicle fusion event. Plays a role in the initial events of the autophagic vacuole development which take place at specialized regions of the endoplasmic reticulum. Also involved in the recycling of membrane proteins. |
Subcellular Location | Endoplasmic reticulum membrane; Peripheral membrane protein. Golgi apparatus membrane; Peripheral membrane protein. Cytoplasm. Preautophagosomal structure membrane; Lipid-anchor; Cytoplasmic side. Note=ER and Golgi when GTP-bound. Cytoplasmic when bound to GDI1. |
Protein Families | Small GTPase superfamily, Rab family |
Database References | KEGG: sce:YFL038C STRING: 4932.YFL038C |
Gene Functions References
- TRAPPIII and Ypt1 control membrane trafficking events under normal growth conditions and during autophagy. PMID: 29109089
- Since these there proteinases belong to the CPY pathway, YPT1 is even believed to up-regulate this trafficking pathway in yeast cells. Future studies, however, should be carried out to discover the mechanisms that allow YPT1 to recruit these proteins into yeast vacuoles PMID: 26895320
- that changes in Ypt1 and Ypt31 activity affect Golgi cisternal progression, early-to-transitional and transitional-to-late, respectively PMID: 26906739
- Ypt1 binds and activates Hrr25 to spatially regulate its kinase activity. PMID: 26195667
- Finally, three sequential steps of this pathway are delineated: Atg9-dependent exit from the ER en route to autophagy, Ypt1- and core Atgs-mediated pre-autophagsomal-structure organization, and Ypt51-mediated delivery of APs to the vacuole PMID: 26181331
- results suggest that Ypt1p is involved in the cellular protection process under heat stress conditions PMID: 26169936
- These findings establish a role for an autophagy-specific Ypt1 module in the regulation of ER-phagy. Moreover, because Ypt1 is a known key regulator of ER-to-Golgi transport, these findings establish a second role for Ypt1 at the ER PMID: 23924895
- Findings show that Ypt1/Rab1 infindings show that Ypt1/Rab1 interacts with Atg1/Ulk1 in yeast and mammalian cells. PMID: 23716696
- Trs85 and Ypt1 are localized to the preautophagosomal structure in an Atg9-dependent manner. PMID: 23129774
- Our findings establish that Ypt1 contributes to regulation of UPR signaling dynamics by promoting the decay of HAC1 RNA, suggesting a potential regulatory mechanism for linking vesicle trafficking to the UPR and ER homeostasis PMID: 22844259
- Ypt1 and Atg11 colocalize with Trs85, a Ypt1 activator subunit, and together they regulate selective autophagy. PMID: 22509044
- Ypt1 is essential for autophagy. PMID: 20375281
- alpha-Synuclein expression blocks ER-to-Golgi vesicular trafficking; in a genomewide screen, the largest class of toxicity modifiers were proteins functioning at this step including Ypt1p which associated with cytoplasmic alphaSyn inclusions PMID: 16794039
- These results show that Trs65 plays a role in the Ypt guanine nucleotide exchanger activity of TRAPP II in concert with the two other TRAPP II-specific subunits. PMID: 17475775
- These results confirm the link between translation and vesicular trafficking and reinforce the implication of eIF5A in protein synthesis. PMID: 18568365
- Study presents the structure of a heteropentameric TRAPPI assembly complexed with Ypt1p & leads to proposal for mechanism for guanine nucleotide exchange in which each subunit in the TRAPPI subassembly contributes to the activity of this multimer. PMID: 18585354
- identify the kinetic and thermodynamic bases by which TRAPP catalyzes nucleotide exchange from Ypt1p PMID: 19361519
- Data show that Gyp1p, a GAP for Ypt1p, specifically interacts with Ypt32p, and that this interaction is important for the localization and stability of Gyp1p. PMID: 19666511