Recombinant Tachypleus Tridentatus Clotting Factor C (FC) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-10585P

Greater than 85% as determined by SDS-PAGE.
Recombinant Tachypleus Tridentatus Clotting Factor C (FC) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-10585P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Tachypleus Tridentatus Clotting Factor C (FC) Protein (His) is produced by our Yeast expression system. This is a protein fragment. |
Purity | Greater than 85% as determined by SDS-PAGE. |
Uniprotkb | P28175 |
Target Symbol | P28175 |
Synonyms | Limulus clotting factor C; FC; EC 3.4.21.84) [Cleaved into: Limulus clotting factor C heavy chain; Limulus clotting factor C light chain; Limulus clotting factor C chain A; Limulus clotting factor C chain B] |
Species | Tachypleus tridentatus (Japanese horseshoe crab) |
Expression System | Yeast |
Tag | N-6His |
Target Protein Sequence | IWNGNSTEIGQWPWQAGISRWLADHNMWFLQCGGSLLNEKWIVTAAHCVTYSATAEIIDPSQFKIYLGKYYRDDSRDDDYVQVREALEIHVNPNYDPGNLNFDIALIQLKTPVTLTTRVQPICLPTDITTREHLKEGTLAVVTGWGLNENNTYSEMIQQAVLPVVAASTCEEGYKEADLPLTVTENMFCAGYKKGRYDACSGDSGGPLVFADDSRTERRWVLEGIVSWGSPSGCGKANQYGGFTKVNVFLSWIRQFI |
Expression Range | 763-1019aa |
Protein Length | Partial |
Mol. Weight | 30.8kDa |
Research Area | Others |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | This enzyme is closely associated with an endotoxin-sensitive hemolymph coagulation system which may play important roles in both hemostasis and host defense mechanisms. Its active form catalyzes the activation of clotting factor B. |
Subcellular Location | Secreted. |
Protein Families | Peptidase S1 family |
Database References | KEGG: ag:BAA14315 |
Tissue Specificity | Expressed in hemocytes (at protein level). |