Recombinant Tityus Serrulatus Beta-Mammal/Insect Toxin Ts1 Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-04818P
Greater than 85% as determined by SDS-PAGE.
Recombinant Tityus Serrulatus Beta-Mammal/Insect Toxin Ts1 Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-04818P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Tityus Serrulatus Beta-Mammal/Insect Toxin Ts1 Protein (His&Myc) is produced by our E.coli expression system. This is a full length protein. |
Purity | Greater than 85% as determined by SDS-PAGE. |
Uniprotkb | P15226 |
Target Symbol | P15226 |
Synonyms | ; Beta-mammal/insect toxin Ts1; PT-Mice-Ins-beta NaTx6.1; Tityustoxin VII; Ts VII; Ts7; TsTX-VII; Toxin II-11; Toxin III-10; Toxin T2-IV; Toxin gamma; TsTX-I |
Species | Tityus serrulatus(Brazilian scorpion) |
Expression System | E.coli |
Tag | N-10His&C-Myc |
Target Protein Sequence | KEGYLMDHEGCKLSCFIRPSGYCGRECGIKKGSSGYCAWPACYCYGLPNWVKVWDRATNKC |
Expression Range | 21-81aa |
Protein Length | Full Length of Mature Protein |
Mol. Weight | 14.3 kDa |
Research Area | Others |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Voltage-gated sodium channels (Nav) gating-modifier. Acts both as alpha- and beta-toxin, since it affects not only activation but also inactivation of Nav channels (Probable). Binds to Nav domain DII and impairs the four Nav channel voltage sensors movements. Depending on Nav channel subtypes tested, can also bind Nav domains DIII (low affinity) and DIV (very low affinity). Acts on almost all the Nav channels tested (mammalian Nav1.2/SCN2A, Nav1.3/SCN3A, Nav1.4/SCN4A, Nav1.5/SCN5A, Nav1.6/SCN8A, Nav1.9/SCN11A, and insect DmNav1). Is highly active against both mammals and insects. Irreversibly modulates DmNav channels. Other Ts1 activities have been studied, such as immunomodulation, antimicrobial activity or exocrine secretion (Probable). This toxin exhibits an antifungal activity against filamentous fungi. In vitro, it has an important immunomodulatory effect on macrophages by stimulating the release of proinflammatory cytokines. It also shows an activity in exocrine secretion in pancreas, stomach and adrenal gland. |
Subcellular Location | Secreted. |
Protein Families | Long (4 C-C) scorpion toxin superfamily, Sodium channel inhibitor family, Beta subfamily |
Tissue Specificity | Expressed by the venom gland. |