Recombinant Viscum Album Viscotoxin-A2 (THI2.3) Protein (hFc)
Beta LifeScience
SKU/CAT #: BLC-06749P

Greater than 85% as determined by SDS-PAGE.
Recombinant Viscum Album Viscotoxin-A2 (THI2.3) Protein (hFc)
Beta LifeScience
SKU/CAT #: BLC-06749P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Viscum Album Viscotoxin-A2 (THI2.3) Protein (hFc) is produced by our Mammalian cell expression system. This is a full length protein. |
Purity | Greater than 85% as determined by SDS-PAGE. |
Uniprotkb | P32880 |
Target Symbol | THI2.3 |
Species | Viscum album (European mistletoe) |
Expression System | Mammalian cell |
Tag | C-hFc |
Target Protein Sequence | KSCCPNTTGRNIYNTCRFGGGSREVCASLSGCKIISASTCPSYPDK |
Expression Range | 1-46aa |
Protein Length | Full Length of Mature Protein |
Mol. Weight | 34.4 kDa |
Research Area | Others |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Thionins are small plant proteins which are toxic to animal cells. They seem to exert their toxic effect at the level of the cell membrane. Their precise function is not known. |
Subcellular Location | Secreted. |
Protein Families | Plant thionin (TC 1.C.44) family |