Recombinant Xenopus Laevis Protein Wnt-8 (WNT8) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-10574P

Greater than 90% as determined by SDS-PAGE.
Recombinant Xenopus Laevis Protein Wnt-8 (WNT8) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-10574P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Xenopus Laevis Protein Wnt-8 (WNT8) Protein (His) is produced by our Yeast expression system. This is a full length protein. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | P28026 |
Target Symbol | WNT8 |
Synonyms | wnt8; Protein Wnt-8; XWnt-8 |
Species | Xenopus laevis (African clawed frog) |
Expression System | Yeast |
Tag | N-6His |
Target Protein Sequence | AWSVNNFLMTGPKAYLTYSASVAVGAQNGIEECKYQFAWERWNCPESTLQLATHNGLRSATRETSFVHAISSAGVMYTLTRNCSMGDFDNCGCDDSRNGRIGGRGWVWGGCSDNAEFGERISKLFVDGLETGQDARALMNLHNNEAGRLAVKETMKRTCKCHGISGSCSIQTCWLQLAEFRDIGNHLKIKHDQALKLEMDKRKMRSGNSADNRGAIADAFSSVAGSELIFLEDSPDYCLKNISLGLQGTEGRECLQSGKNLSQWERRSCKRLCTDCGLRVEEKKTEIISSCNCKFHWCCTVKCEQCKQVVIKHFCARRERDSNMLNTKRKNRGHRR |
Expression Range | 23-358aa |
Protein Length | Full Length of Mature Protein |
Mol. Weight | 39.7kDa |
Research Area | Others |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Ligand for members of the frizzled family of seven transmembrane receptors. Plays a role in ventral mesodermal patterning during embryogenesis. Mimics Nieuwkoop center activity. Causes dorsal mesodermal differentiation of animal cap ectoderm when coexpressed with noggin and nuclear, sequence-specific DNA-binding protein xBra. None of these molecules causes dorsal mesoderm formation when expressed alone. |
Subcellular Location | Secreted, extracellular space, extracellular matrix. |
Protein Families | Wnt family |
Database References | KEGG: xla:397970 UniGene: Xl.49 |
Gene Functions References
- Data show that Noggin4 fine-tune the Wnt8 posterior-to-anterior gradient. PMID: 26973133
- EFHC1 domains are involved in ciliary localization, ciliogenesis, and the regulation of Wnt8a signaling PMID: 26783883
- Sulf1 inhibits the ability of Wnt8a to activate the canonical Wnt signalling pathway. PMID: 25681501
- study presents the structure of Xenopus Wnt8 (XWnt8) in complex with the mouse Fz8-cysteine-rich domain to a resolution of 3.25 A PMID: 22653731
- Xwnt8 directly initiates expression of labial Hox genes. PMID: 19623617
- Wnt8 conveyed by Frizzled-related proteins can activate canonical Wnt signalling despite the function of Frizzled-related proteins as Wnt inhibitors, suggesting a novel regulatory system for Wnts by sFRPs PMID: 19906850
- by performing gain- and loss-of-function of Wnt signaling experiments, we show that this pathway plays an important role not only in neural crest induction but also in the specification of the neural crest competence territory PMID: 14699582
- Wnt8 may stimulate a cellular phosphatase to dephosphorylate and activate CKIepsilon PMID: 14722104
- Molecular modeling of the complex between the xWNT8 protein and the CRD domain of mFZD8 PMID: 17506343
- Xwnt8-mediated posteriorization is restricted to the eye level and is independent of mesoderm formation. PMID: 18318733
- Fgf8a induces neural crest (NC) indirectly through the activation of Wnt8 in the paraxial mesoderm, which in turn promotes NC formation in the overlying ectoderm primed by Bmp antagonists. PMID: 18997112