Recombinant Human CLECSF6 Protein
Beta LifeScience
SKU/CAT #: BLA-1231P
Recombinant Human CLECSF6 Protein
Beta LifeScience
SKU/CAT #: BLA-1231P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Synonym | C type (calcium dependent carbohydrate recognition domain) lectin superfamily member 6 C type lectin C type lectin DDB27 C type lectin superfamily 6 C-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamily member 6 C-type lectin superfamily member 6 C-type lectin DDB27 C-type lectin domain family 4 member A C-type lectin domain family 4, member A C-type lectin domain family 4, member a2 C-type lectin superfamily member 6 CLC4A_HUMAN Clec4a Clec4a2 CLECSF6 DCIR Dcir1 DDB27 Dendritic cell immunoreceptor HDCGC13P Lectin like immunoreceptor Lectin, C-type, superfamily member 6 Lectin-like immunoreceptor LLIR |
Description | Recombinant Human CLECSF6 Protein was expressed in Wheat germ. It is a Full length protein |
Source | Wheat germ |
AA Sequence | MTSEITYAEVRFKNEFKSSGINTASSAASKERTAPHKSNTGFPKLLCASL LIFFLLLAISFFIAFVIFFQKYSQLLEKKTTKELVHTTLECVKKNMPVEE TAWSCCPKNWKSFSSNCYFISTESASWQDSEKDCARMEAHLLVINTQEEQ DFIFQNLQEESAYFVGLSDPEGQRHWQWVDQTPYNESSTFWHPREPSDPN ERCVVLNFRKSPKRWGWNDVNCLGPQRSVCEMMKIHL |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle. |