Recombinant Human G-CSF Protein (Animal Free)
Beta LifeScience
SKU/CAT #: BLA-1514P
Recombinant Human G-CSF Protein (Animal Free)
Beta LifeScience
SKU/CAT #: BLA-1514P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | P09919-2 |
Synonym | C17orf33 Colony stimulating factor 3 Colony stimulating factor 3 (granulocyte) CSF 3 CSF beta CSF3 CSF3_HUMAN CSF3OS Csfg Filgrastim G-CSF GCSA GCSF Granulocyte colony stimulating factor Granulocyte colony-stimulating factor Lenograstim Macrophage granulocyte inducer 2 MGC45931 MGI 2 Pluripoietin |
Description | Recombinant Human G-CSF Protein (Animal Free) was expressed in E.coli. It is a Protein fragment |
Source | E.coli |
AA Sequence | MTPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVL LGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPEL GPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAG GVLVASHLQSFLEVSYRVLRHLAQP |
Molecular Weight | 19 kDa |
Purity | >95% purity as determined by SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Bioactivity | NFS-60 cell proliferation.ED50 -‰¤50 pg/ml; -‰¥ 2 x 107 units/mg (typical ED50 is 5-15 pg/ml). |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at -20°C. Avoid freeze / thaw cycle. |