Recombinant rhesus monkey CSF3 Protein
Beta LifeScience
SKU/CAT #: BLA-1910P
Recombinant rhesus monkey CSF3 Protein
Beta LifeScience
SKU/CAT #: BLA-1910P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Rhesus monkey |
Accession | F7H1Q6 |
Description | Recombinant rhesus monkey CSF3 Protein was expressed in E.coli. It is a Protein fragment |
Source | E.coli |
AA Sequence | TPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLL RHSLGIPWAPLSSCPSQALQLTGCLSQLHSSLFLYQGLLQALEGISPELS PTLDTLQLDIADFATTIWQQMEDLGMAPALQPTQGAMPAFTSAFQRRAGG VLVASHLQRFLELAYRVLRHLAQS |
Molecular Weight | 19 kDa |
Purity | >98% SDS-PAGE.Purity >98% as determined by SDS-PAGE and HPLC. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Bioactivity | Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine NFS-60 cells is less than 0.05 ng/ml, corresponding to a specific activity of >2.0x107 IU/mg. |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |